| CatalogCode: | | H00003043-M02 |
| ProductName: | | HBB Antibody |
| Product Description: | | Mouse Monoclonal anti-HBB (7B12) |
| Clone: | | 7B12 |
| Clonality: | | Monoclonal |
| Immunogen: | | HBB (AAH07075, 38 a.a. ~ 148 a.a) partial recombinant protein with GST tag. |
| Epitope: | | WTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH* ... |
| Specificity: | | HBB - hemoglobin, beta |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.1 mg IgG purified Mouse ascites. |
| Uses: | | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. This antibody has also been used in Immunohistochemistry of paraffin embedded sections. |
| Background: | | The alpha (HBA) and beta (HBB) loci determine the structure of the 2 types of polypeptide chains in adult hemoglobin, Hb A. The normal adult hemoglobin tetramer consists of two alpha chains and two beta chains. Mutant beta globin causes sickle cell anemia. Absence of beta chain causes beta-zero-thalassemia. Reduced amounts of detectable beta globin causes beta-plus-thalassemia. The order of the genes in the beta-globin cluster is 5'-epsilon -- gamma-G -- gamma-A -- delta -- beta--3'. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | IgG purified |
| Isotype: | | IgG1 Kappa |
| Host_Name: | | Mouse |
| ListPrice: | | 295 |
| AppSummary: | | ELISA, WB, IHC-P |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-CD113t-C antibody, anti-HBD antibody, anti-hemoglobin antibody |
| ProteinTarget: | | HBB - hemoglobin, beta |
| PackageSize: | | 0.1 mg |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 3043 |
| Gene_Symbol: | | HBB |
| Omim_ID: | | 141900, 603902, |
| more information: | | company product webpage |