ExactAntigen

Mouse Polyclonal anti-HARS
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00003035-A01
ProductName:HARS Antibody
Product Description:Mouse Polyclonal anti-HARS
Clonality:Polyclonal
Immunogen:HARS (NP_002100, 1 a.a. ~ 97 a.a) partial recombinant protein with GST tag.
Epitope:MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPV* ...
Specificity:HARS - histidyl-tRNA synthetase
CrossReactivity:Human. Other species not tested.
Packaging:0.05 ml of mouse antisera with 50% glycerol. No preservative.
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnova's recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<br>1:500-1:1000 for polysera
Background:Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. The protein encoded by this gene is a cytoplasmic enzyme which belongs to the class II family of aminoacyl-tRNA synthetases. The enzyme is responsible for the synthesis of histidyl-transfer RNA, which is essential for the incorporation of histidine into proteins. The gene is located in a head-to-head orientation with HARSL on chromosome five, where the homologous genes share a bidirectional promoter. The gene product is a frequent target of autoantibodies in the human autoimmune disease polymyositis/dermatomyositis.
ProductRef:Chardonnet S, et al. New mortalin and histidyl tRNA synthetase isoforms point out a pitfall in proteomic analysis of Egr1 genetically modified mice. Proteomics. 7(2):289-98, 2007.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:Whole antisera
Host_Name:Mouse
ListPrice:225
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-FLJ20491 antibody, anti-HRS antibody
ProteinTarget:HARS - histidyl-tRNA synthetase
PackageSize:0.05 ml
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:3035
Gene_Symbol:HARS
Omim_ID:142810 H00003035-M01
see all human histidyl tRNA synthetase antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about