| Catalog Code: | H00003026-M01 |
| Product Type: | Primary Antibody |
| Product Name: | HABP2 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 3026 |
| Host: | Mouse |
| Clone: | 1H4 |
| Isotype: | IgG2a Kappa |
| Product Description: | Mouse Monoclonal anti-HABP2 (1H4) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 7-10. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours.The protein encoded by this gene is an extracellular serine p |
| Alternate Names: | anti-FSAP antibody, anti-HABP antibody, anti-HGFAL antibody, anti-PHBP antibody |
| Immunogen: | HABP2 (NP_004123, 105 a.a. ~ 205 a.a) partial recombinant protein with GST tag. |
| Epitope: | GNKCQKVQNTCKDNPCGRGQCLITQSPPYYRCVCKHPYTGPSCSQVVPVCRPNPCQNGATCSRHKRRSKFTCACPDQFKGKFCEIGSDDCYVGDGYSYRG* ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Packaging: | 100 ug purified IgG |
| Package Size: | 100 ug |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Application Summary: | ELISA |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | HABP2 |
| Omim ID: | 603924, |