| Catalog Code: | H00003021-M01 |
| Product Type: | Primary Antibody |
| Product Name: | H3F3B Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 3021 |
| Host: | Mouse |
| Clone: | 2D7-H1 |
| Isotype: | IgG1 kappa |
| Product Description: | Mouse Monoclonal anti-H3F3B (2D7-H1) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | NCBI Entrez Gene ID = H3F3B PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.Histones are basic |
| Alternate Names: | anti-H3.3B antibody |
| Immunogen: | H3F3B (AAH17558, 1 a.a. ~ 137 a.a) full length recombinant protein with GST tag. |
| Epitope: | MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA* ... |
| Specificity: | H3F3B - H3 histone, family 3B (H3.3B) |
| Purity: | IgG purified |
| Packaging: | 100 ug purified IgG |
| Package Size: | 0.1 ml |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. This antibody has also been used in Immunohistochemistry of paraffin embedded sections. |
| Application Summary: | ELISA, WB, IHC-P |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | H3F3B |
| Omim ID: | 601058 |