| CatalogCode: | H00002954-A01 |
| ProductName: | GSTZ1 Antibody |
| Product Description: | Mouse Polyclonal anti-GSTZ1 |
| Clonality: | Polyclonal |
| Immunogen: | GSTZ1 (NP_665877, 109 a.a. ~ 217 a.a) partial recombinant protein with GST tag. |
| Epitope: | GIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA* ... |
| Specificity: | GSTZ1 - glutathione transferase zeta 1 (maleylacetoacetate isomerase) |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500-1:1000 for polysera |
| Background: | This gene is a member of the glutathione S-transferase (GSTs) super-family which encodes multifunctional enzymes important in the detoxification of electrophilic molecules, including carcinogens, mutagens, and several therapeutic drugs, by conjugation with glutathione. This enzyme also plays a significant role in the catabolism of phenylalanine and tyrosine. Thus defects in this enzyme may lead to severe metabolic disorders including alkaptonuria, phenylketonuria and tyrosinaemia. Several transcript variants of this gene encode multiple protein isoforms. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-GSTZ1-1 antibody, anti-MAAI antibody, anti-MAI antibody, anti-MGC2029 antibody |
| ProteinTarget: | GSTZ1 - glutathione transferase zeta 1 (maleylacetoacetate isomerase) |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 2954 |
| Gene_Symbol: | GSTZ1 |
| Omim_ID: | 603758 H00002954-M01 |
order or more information: | company product webpage |
| request information: | |