| request information: |
|
| Catalog Code: | H00002916-M01 |
| Product Name: | GRM6 Antibody |
| Product Description: | Mouse Monoclonal anti-GRM6 (1A11) |
| Clone: | 1A11 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 2916 |
| Gene Symbol: | GRM6 |
| Omim ID: | 604096, |
| Immunogen: | GRM6 (NP_000834, 477 a.a. ~ 567 a.a) partial recombinant protein with GST tag. |
| Epitope: | ATNGSASSGGYQAVGQWAETLRLDVEALQWSGDPHEVPSSLCSLPCGPGERKKMVKGVPCCWHCEACDGYRFQVDEFTC
EACPGDMRPTP* |
| Specificity: | GRM6 - glutamate receptor, metabotropic 6 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5 and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3 while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivities. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DKFZp686H1993 antibody, anti-GPRC1F antibody, anti-MGLUR6 antibody, anti-mGlu6 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |