| CatalogCode: | | H00002909-M01 |
| ProductName: | | GRLF1 Antibody |
| Product Description: | | Mouse Monoclonal anti-GRLF1 (4D4-F8) |
| Clone: | | 4D4-F8 |
| Clonality: | | Monoclonal |
| Immunogen: | | GRLF1 (AAH03514, 1 a.a. ~ 37 a.a) full length recombinant protein with GST tag. |
| Epitope: | | MEATSRSVHGDVGEVGHFEGMAVCWCPRRGILPGLR* |
| Specificity: | | GRLF1 - glucocorticoid receptor DNA binding factor 1 |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.1 mg IgG purified Mouse ascites. |
| Uses: | | Antibody reactive against recombinant protein on ELISA. |
| Background: | | The human glucocorticoid receptor DNA binding factor, which associates with the promoter region of the glucocorticoid receptor gene (hGR gene), is a repressor of glucocorticoid receptor transcription. The amino acid sequence deduced from the cDNA sequences show the presence of three sequence motifs characteristic of a zinc finger and one motif suggestive of a leucine zipper in which 1 cysteine is found instead of all leucines. The GRLF1 enhances the homologous down-regulation of wild-type hGR gene expression. Biochemical analysis suggests that GRLF1 interaction is sequence specific and that transcriptional efficacy of GRLF1 is regulated through its interaction with specific sequence motif. The level of expression is regulated by glucocorticoids. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | IgG purified |
| Isotype: | | IgG2a kappa |
| Host_Name: | | Mouse |
| ListPrice: | | 295 |
| AppSummary: | | ELISA |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-GRF-1 antibody, anti-KIAA1722 antibody, anti-MGC10745 antibody, anti-P190-A antibody, anti-P190A antibody, anti-p190RhoGAP antibody |
| ProteinTarget: | | GRLF1 - glucocorticoid receptor DNA binding factor 1 |
| PackageSize: | | 0.1 mg |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 2909 |
| Gene_Symbol: | | GRLF1 |
| Omim_ID: | | 605277 H00002911-A01 |
| more information: | | company product webpage |