| Catalog Code: | H00002873-M01 |
| Product Type: | Primary Antibody |
| Product Name: | GPS1 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 2873 |
| Host: | Mouse |
| Clone: | 1E8 |
| Isotype: | IgG2b kappa |
| Product Description: | Mouse Monoclonal anti-GPS1 (1E8) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | NCBI Entrez Gene ID = GPS1 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.This gene is known t |
| Alternate Names: | anti-COPS1 antibody, anti-CSN1 antibody, anti-MGC71287 antibody |
| Immunogen: | GPS1 (AAH00155, 390 a.a. ~ 491 a.a) partial recombinant protein with GST tag. |
| Epitope: | AAAFNTTVAALEDELTQLILEGLISARVDSHSKILYARDVDQRSTTFEKSLLMGKEFQRRAKAMMLRAAVLRNQIHVKSPPREGSQGELTPANSQSRMSTNM ... |
| Specificity: | GPS1 - G protein pathway suppressor 1 |
| Purity: | IgG purified |
| Packaging: | 100 ug purified IgG |
| Package Size: | 0.1 ml |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Application Summary: | ELISA |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | GPS1 |
| Omim ID: | 601934 |