ExactAntigen

GRK4 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00002868-M09
Product Type:Primary Antibody
Product Name:GRK4 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:2868
Host:Mouse
Clone:1F7
Isotype:IgG2b Kappa
Product Description:Mouse Monoclonal anti-GRK4 (1F7)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = GRK4 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.This gene encodes a
Alternate Names:anti-GPRK2L antibody, anti-GPRK4 antibody, anti-GRK4a antibody, anti-IT11 antibody
Immunogen:GRK4 (NP_892027, 36 a.a. ~ 145 a.a) partial recombinant protein with GST tag.
Epitope:LPPVSQCSELRHSIEKDYSSLCDKQPIGRRLFRQFCDTKPTLKRHIEFLDAVAEYEVADDEDRSDCGLSILDRFFNDKLAAPLPEIPPDVVTECRLGLKEENPSKKAFEE ...
Specificity:GRK4 - G protein-coupled receptor kinase 4
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:GRK4
Omim ID:137026,
see all human G protein coupled receptor kinase 4 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about