| CatalogCode: | H00002868-M02 |
| ProductName: | GRK4 Antibody |
| Product Description: | Mouse Monoclonal anti-GRK4 (6D5) |
| Clone: | 6D5 |
| Clonality: | Monoclonal |
| Immunogen: | GRK4 (NP_892027, 36 a.a. ~ 145 a.a) partial recombinant protein with GST tag. |
| Epitope: | LPPVSQCSELRHSIEKDYSSLCDKQPIGRRLFRQFCDTKPTLKRHIEFLDAVAEYEVADDEDRSDCGLSILDRFFNDKLAAPLPEIPPDVVTECRLGLKEENPSKKAFEE ... |
| Specificity: | GRK4 - G protein-coupled receptor kinase 4 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating its deactivation. This gene has been linked to both genetic and acquired hypertension. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-GPRK2L antibody, anti-GPRK4 antibody, anti-GRK4a antibody, anti-IT11 antibody |
| ProteinTarget: | GRK4 - G protein-coupled receptor kinase 4 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 2868 |
| Gene_Symbol: | GRK4 |
| Omim_ID: | 137026, |