| request information: |
|
| Catalog Code: | H00002794-A01 |
| Product Name: | GNL1 Antibody |
| Product Description: | Mouse Polyclonal anti-GNL1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 2794 |
| Gene Symbol: | GNL1 |
| Omim ID: | 143024, |
| Immunogen: | GNL1 (NP_005266, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. |
| Epitope: | ELLELDIREVYQPGSVLDFPRRPPWSYEMSKEQLMSQEERSFQDYLGKIHGAYSSEKLSYFEHNLETWRQLWRVLEMSD
IVLLITDIRHPVVNFPPALY* |
| Specificity: | GNL1 - guanine nucleotide binding protein-like 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The GNL1 gene, identified in the human major histocompatibility complex class I region, shows a high degree of similarity with its mouse counterpart. The GNL1 gene is located less than 2 kb centromeric to HLA-E, in the same transcriptional orientation. GNL1 is telomeric to HLA-B and HLA-C. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-HSR1 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |