ExactAntigen

Mouse Polyclonal anti-GNGT1
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00002792-B01
ProductName:GNGT1 Antibody
Product Description:Mouse Polyclonal anti-GNGT1
Clonality:Polyclonal
Immunogen:GNGT1 (AAH29367, 1 a.a. ~ 75 a.a) full-length human protein.
Epitope:MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGGCVIS* ...
CrossReactivity:Human. Other species not tested.
Packaging:0.05 ml of mouse antisera with 50% glycerol.
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background:Heterotrimeric guanine nucleotide-binding proteins (G proteins) transduce extracellular signals received by transmembrane receptors to effector proteins. Transducin is a guanine nucleotide-binding protein found specifically in rod outer segments, where it mediates activation by rhodopsin of a cyclic GTP-specific (guanosine monophosphate) phosphodiesterase. Transducin is also referred to as GMPase. GNGT1 encodes the gamma subunit of transducin (Hurley et al., 1984 [PubMed 6438626]; Scherer et al., 1996 [PubMed 8661128]).[supplied by OMIM]
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Host_Name:Mouse
ListPrice:295
AppSummary:WB, ELISA
SpeciesSummary:Hu
ALTnames:anti-GNG1 antibody
ProteinTarget:guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1
PackageSize:0.05 ml
NotesMain:This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova.
Gene_Id:2792
Gene_Symbol:GNGT1
Omim_ID:189970,
see all human GNGT1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about