ExactAntigen

GMFB Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00002764-M01
Product Type:Primary Antibody
Product Name:GMFB Antibody
List Price:275
Clonality:Monoclonal
Gene ID:2764
Host:Mouse
Clone:2G12-2A2
Isotype:IgG1 kappa
Product Description:Mouse Monoclonal anti-GMFB (2G12-2A2)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = GMFB PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-GMF antibody
Immunogen:GMFB (AAH05359, 1 a.a. ~ 155 a.a) full length recombinant protein with GST tag.
Epitope:MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFTNVNFCVSKVFMY* ...
Specificity:GMFB - glia maturation factor, beta
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates and has been used in immunofluorescence.
Application Summary:ELISA, WB, IF
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:GMFB
Omim ID:601713
see all human GMFB antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about