ExactAntigen

GLUL Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00002752-M01
Product Type:Primary Antibody
Product Name:GLUL Antibody
List Price:275
Clonality:Monoclonal
Gene ID:2752
Host:Mouse
Clone:2B12
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-GLUL (2B12)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = GLUL PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.Glutamine is a main
Alternate Names:anti-GLNS antibody, anti-GS antibody
Immunogen:GLUL (AAH10037, 1 a.a. ~ 374 a.a) full length recombinant protein with GST tag.
Epitope:MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTN ...
Specificity:GLUL - glutamate-ammonia ligase (glutamine synthetase)
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemis
Application Summary:ELISA, WB, IHC-P
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:GLUL
Omim ID:138290,
see all human glutamine synthetase antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about