| CatalogCode: | H00002741-M01 |
| ProductName: | glycine receptor, alpha 1 Antibody |
| Product Description: | Mouse Monoclonal anti-glycine receptor, alpha 1 (2E6) |
| Clone: | 2E6 |
| Clonality: | Monoclonal |
| Immunogen: | GLRA1 (NP_000162, 121 a.a. ~ 221 a.a) partial recombinant protein with GST tag. |
| Epitope: | IWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEE* ... |
| Specificity: | glycine receptor, alpha 1 (startle disease/hyperekplexia, stiff man syndrome) |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | The inhibitory glycine receptor mediates postsynaptic inhibition in the spinal cord and other regions of the central nervous system. It is a pentameric receptor composed of alpha and beta subunits. The GLRB gene (MIM 138492) encodes the beta subunit of the receptor.[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| Buffer: | 1X PBS pH 7.2 |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-STHE antibody |
| ProteinTarget: | glycine receptor, alpha 1 (startle disease/hyperekplexia, stiff man syndrome) |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 2741 |
| Gene_Symbol: | GLRA1 |
| Omim_ID: | 138491, 149400, |
order or
more information: | company product webpage |
| request information: |
|