ExactAntigen

Mouse Monoclonal anti-GGCX (5A9) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00002677-M03
ProductName: GGCX Antibody
Product Description: Mouse Monoclonal anti-GGCX (5A9)
Clone: 5A9
Clonality: Monoclonal
Immunogen: GGCX (NP_000812, 533 a.a. ~ 630 a.a) partial recombinant protein with GST tag.
Epitope: ADFPGLHLENFVSEDLGNTSIQLLQGEVTVELVAEQKNQTLREGEKMQLPAGEYHKVYTTSPSPSCYMYVYVNTTELALEQDLAYLQELKEKVENGS* ...
Specificity: GGCX - gamma-glutamyl carboxylase
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemistry on paraffin-embedded sections.
Background: Gamma-glutamyl carboxylase accomplishes the posttranslational modification required for the activity of all of the vitamin K-dependent proteins (Wu et al., 1991 [PubMed 1749935]). These include some of the blood coagulation and anticoagulation proteins as well as bone gamma-carboxyglutamic acid (Gla) protein (BGLAP; MIM 112260) and bone matrix protein (MGP; MIM 154870).[supplied by OMIM]
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG1 Kappa
Host_Name: Mouse
ListPrice: 295
AppSummary: ELISA, WB, IHC-P
SpeciesSummary: Hu
ALTnames: anti-VKCFD1 antibody
ProteinTarget: GGCX - gamma-glutamyl carboxylase
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 2677
Gene_Symbol: GGCX
Omim_ID: 137167, 277450,
more information: company product webpage
Also see:
see all human GGCX antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about