| CatalogCode: | | H00002677-M03 |
| ProductName: | | GGCX Antibody |
| Product Description: | | Mouse Monoclonal anti-GGCX (5A9) |
| Clone: | | 5A9 |
| Clonality: | | Monoclonal |
| Immunogen: | | GGCX (NP_000812, 533 a.a. ~ 630 a.a) partial recombinant protein with GST tag. |
| Epitope: | | ADFPGLHLENFVSEDLGNTSIQLLQGEVTVELVAEQKNQTLREGEKMQLPAGEYHKVYTTSPSPSCYMYVYVNTTELALEQDLAYLQELKEKVENGS* ... |
| Specificity: | | GGCX - gamma-glutamyl carboxylase |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.1 mg IgG purified Mouse ascites. |
| Uses: | | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemistry on paraffin-embedded sections. |
| Background: | | Gamma-glutamyl carboxylase accomplishes the posttranslational modification required for the activity of all of the vitamin K-dependent proteins (Wu et al., 1991 [PubMed 1749935]). These include some of the blood coagulation and anticoagulation proteins as well as bone gamma-carboxyglutamic acid (Gla) protein (BGLAP; MIM 112260) and bone matrix protein (MGP; MIM 154870).[supplied by OMIM] |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | IgG purified |
| Isotype: | | IgG1 Kappa |
| Host_Name: | | Mouse |
| ListPrice: | | 295 |
| AppSummary: | | ELISA, WB, IHC-P |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-VKCFD1 antibody |
| ProteinTarget: | | GGCX - gamma-glutamyl carboxylase |
| PackageSize: | | 0.1 mg |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 2677 |
| Gene_Symbol: | | GGCX |
| Omim_ID: | | 137167, 277450, |
| more information: | | company product webpage |