| CatalogCode: | | H00002670-A01 |
| ProductName: | | GFAP Antibody |
| Product Description: | | Mouse Polyclonal anti-GFAP |
| Clonality: | | Polyclonal |
| Immunogen: | | GFAP (AAH41765, 131 a.a. ~ 231 a.a) partial recombinant protein with GST tag. |
| Epitope: | | TANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEVRELQEQLARQQVHVELDVAKPD* ... |
| Specificity: | | GFAP - glial fibrillary acidic protein |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | | This gene encodes one of the major intermediate filament proteins of mature astrocytes. It is used as a marker to distinguish astrocytes from other glial cells during development. Mutations in this gene cause Alexander disease, a rare disorder of astrocytes in the central nervous system. An additional transcript variant has been described, but its full length sequence has not been determined. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | Whole antisera |
| Host_Name: | | Mouse |
| ListPrice: | | 225 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-Astrocyte antibody, anti-Glial Fibrillary Acidic Protein antibody, anti-FLJ45472 antibody |
| ProteinTarget: | | GFAP - glial fibrillary acidic protein |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 2670 |
| Gene_Symbol: | | GFAP |
| Omim_ID: | | 137780, 203450, |
| more information: | | company product webpage |