ExactAntigen

Mouse Monoclonal anti-GDI1 (1H3)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00002664-M08
ProductName:GDI1 Antibody
Product Description:Mouse Monoclonal anti-GDI1 (1H3)
Clone:1H3
Clonality:Monoclonal
Immunogen:GDI1 (AAH00317, 1 a.a. ~ 448 a.a) full length recombinant protein with GST tag.
Epitope:MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQLLEGPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGVDPQTTSMRDVYRKFDLGQDVIDFTGHALALYRTDDYLDQPCLETVNRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPV ...
Specificity:GDI1 - GDP dissociation inhibitor 1
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Background:GDP dissociation inhibitors are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, small GTP-binding proteins of the ras superfamily, that are involved in vesicular trafficking of molecules between cellular organelles. GDIs slow the rate of dissociation of GDP from rab proteins and release GDP from membrane-bound rabs. GDI1 is expressed primarily in neural and sensory tissues. Mutations in GDI1 have been linked to X-linked nonspecific mental retardation.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-GDIL antibody, anti-MRX41 antibody, anti-MRX48 antibody, anti-OPHN2 antibody, anti-RABGD1A antibody, anti-RABGDIA antibody, anti-RHOGDI antibody, anti-XAP-4 antibody
ProteinTarget:GDI1 - GDP dissociation inhibitor 1
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:2664
Gene_Symbol:GDI1
Omim_ID:300104, 309541,
see all human GDI1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about