| CatalogCode: | | H00002649-A01 |
| ProductName: | | NR6A1 Antibody |
| Product Description: | | Mouse Polyclonal anti-NR6A1 |
| Clonality: | | Polyclonal |
| Immunogen: | | NR6A1 (NP_001480, 366 a.a. ~ 475 a.a) partial recombinant protein with GST tag. |
| Epitope: | | RLIYLYHKFHQLKVSNEEYACMKAINFLNQDIRGLTSASQLEQLNKRYWYICQDFTEYKYTHQPNRFPDLMMCLPEIRYIAGKMVNVPLEQLPLLFKVVLHSCKTSVGK* ... |
| Specificity: | | NR6A1 - nuclear receptor subfamily 6, group A, member 1 |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | | This gene encodes an orphan nuclear receptor which is a member of the nuclear hormone receptor family. Its expression pattern suggests that it may be involved in neurogenesis and germ cell development. The protein can homodimerize and bind DNA, but in vivo targets have not been identified. The gene expresses at least alternatively spliced transcript variants. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | Whole antisera |
| Host_Name: | | Mouse |
| ListPrice: | | 225 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-GCNF antibody, anti-GCNF1 antibody, anti-NR61 antibody, anti-RTR antibody |
| ProteinTarget: | | NR6A1 - nuclear receptor subfamily 6, group A, member 1 |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 2649 |
| Gene_Symbol: | | NR6A1 |
| Omim_ID: | | 602778 H00002649-B01 |
| more information: | | company product webpage |