ExactAntigen

GCH1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00002643-M03
Product Type:Primary Antibody
Product Name:GCH1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:2643
Host:Mouse
Clone:1F5
Isotype:IgG2b Kappa
Product Description:Mouse Monoclonal anti-GCH1 (1F5)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = GCH1 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.This gene encodes a
Alternate Names:anti-DYT5 antibody, anti-GCH antibody, anti-GTP-CH-1 antibody, anti-GTPCH1 antibody
Immunogen:GCH1 (AAH25415, 1 a.a. ~ 251 a.a) full length recombinant protein with GST tag.
Epitope:MEKGPVRAPAEKPRGARCSNGFPERDPPRPGPSRPAEKPPRPEAKSAQPADGWKGERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS* ...
Specificity:GCH1 - GTP cyclohydrolase 1 (dopa-responsive dystonia)
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody reactive against recombinant protein on ELISA.
Application Summary:ELISA
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:GCH1
Omim ID:128230, 233910, 600225,
see all human GCH1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about