| Catalog Code: | H00002637-M04 |
| Product Type: | Primary Antibody |
| Product Name: | GBX2 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 2637 |
| Host: | Mouse |
| Clone: | 1C11 |
| Isotype: | IgG2b Kappa |
| Product Description: | Mouse Monoclonal anti-GBX2 (1C11) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | GBX2 (Gastrulation brain homeobox 2) is a homeobox protein which is involved in enbryonic cell pluripotency and differentiation. GBX2 is expressed in all three embryonic germ layers of the late gastrula/early neurula. Gbx2 is overexpressed in a panel of h |
| Immunogen: | GBX2 (NP_001476, 114 a.a. ~ 183 a.a) partial recombinant protein with GST tag. |
| Epitope: | ASPQHQEAAAARKFAPQPLPGGGNFDKAEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRGQG* ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Packaging: | 100 ug purified IgG |
| Package Size: | 100 ug |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Application Summary: | ELISA |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | GBX2 |
| Omim ID: | 601135, |