ExactAntigen

GBX2 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00002637-M04
Product Type:Primary Antibody
Product Name:GBX2 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:2637
Host:Mouse
Clone:1C11
Isotype:IgG2b Kappa
Product Description:Mouse Monoclonal anti-GBX2 (1C11)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:GBX2 (Gastrulation brain homeobox 2) is a homeobox protein which is involved in enbryonic cell pluripotency and differentiation. GBX2 is expressed in all three embryonic germ layers of the late gastrula/early neurula. Gbx2 is overexpressed in a panel of h
Immunogen:GBX2 (NP_001476, 114 a.a. ~ 183 a.a) partial recombinant protein with GST tag.
Epitope:ASPQHQEAAAARKFAPQPLPGGGNFDKAEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRGQG* ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:100 ug purified IgG
Package Size:100 ug
Uses:Antibody reactive against recombinant protein on ELISA.
Application Summary:ELISA
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:GBX2
Omim ID:601135,
see all human GBX2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about