| Catalog Code: | H00002629-A01 |
| Product Type: | Primary Antibody |
| Product Name: | GBA Antibody |
| List Price: | 205 |
| Clonality: | Polyclonal |
| Gene ID: | 2629 |
| Host: | Mouse |
| Product Description: | Mouse Polyclonal anti-GBA |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | This gene encodes a lysosomal membrane protein that cleaves the beta-glucosidic linkage of glycosylceramide, an intermediate in glycolipid metabolism. Mutations in this gene cause Gaucher disease, a lysosomal storage disease characterized by an accumulati |
| Alternate Names: | anti-GBA1 antibody, anti-GCB antibody, anti-GLUC antibody |
| Immunogen: | GBA (NP_000148, 146 a.a. ~ 236 a.a) partial recombinant protein with GST tag. |
| Epitope: | SYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAVNGKGS* ... |
| Specificity: | GBA - glucosidase, beta; acid (includes glucosylceramidase) |
| Purity: | Whole antisera |
| Packaging: | 50 ul Whole antisera Mouse antisera. |
| Package Size: | 50 ul |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnova's recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<b |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | GBA |
| Omim ID: | 230800, 231005, 606463, |