| request information: |
|
| Catalog Code: | H00002597-A01 |
| Product Name: | GAPDH Antibody |
| Product Description: | Mouse Polyclonal anti-GAPDH |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 2597 |
| Gene Symbol: | GAPDH |
| Omim ID: | 138400 |
| Immunogen: | GAPDH (NP_002037, 226 a.a. ~ 336 a.a) partial recombinant protein with GST tag. |
| Epitope: | GKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALN
DHFVKLISWYDNEFGYSNRVVDLMAHMASKE* |
| Specificity: | GAPDH - glyceraldehyde-3-phosphate dehydrogenase |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | Glyceraldehyde-3-phosphate dehydrogenase catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. A GAPD pseudogene has been mapped to Xp21-p11 and 15 GAPD-like loci have been identified. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-GAPDH antibody, anti-glyceraldehyde-3-phosphate dehydrogenase antibody, anti-HGNC:4141 antibody, anti-G3PD antibody, anti-GAPD antibody, anti-MGC88685 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |