ExactAntigen

GALK1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00002584-A02
Product Type:Primary Antibody
Product Name:GALK1 Antibody
List Price:205
Clonality:Polyclonal
Gene ID:2584
Host:Mouse
Product Description:Mouse Polyclonal anti-GALK1
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:Galactokinase is a major enzyme for the metabolism of galactose and its deficiency causes congenital cataracts during infancy and presenile cataracts in the adult population. PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, deliver
Alternate Names:anti-GALK antibody, anti-GK1 antibody
Immunogen:GALK1 (NP_000145, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag.
Epitope:PCGIMDQFISLMGQKGHALLIDCRSLETSLVPLSDPKLAVLITNSNVRHSLASSEYPVRRRQCEEVARALGKESLREVQLEELEAARDLVSKEGFRRAR* ...
Specificity:Mouse polyclonal antibody raised against a partial recombinant GALK1.
Purity:Whole antisera
Packaging:50 ul of mouse antisera with 50% glycerol.
Package Size:0.05 ml
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein and cell lysates. Abnova's recommended working dilutions for western analysis are as follows:1:500-1:1000 for polysera
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:GALK1
Omim ID:230200, 604313,
see all human GALK1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about