| Catalog Code: | H00002584-A02 |
| Product Type: | Primary Antibody |
| Product Name: | GALK1 Antibody |
| List Price: | 205 |
| Clonality: | Polyclonal |
| Gene ID: | 2584 |
| Host: | Mouse |
| Product Description: | Mouse Polyclonal anti-GALK1 |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | Galactokinase is a major enzyme for the metabolism of galactose and its deficiency causes congenital cataracts during infancy and presenile cataracts in the adult population. PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, deliver |
| Alternate Names: | anti-GALK antibody, anti-GK1 antibody |
| Immunogen: | GALK1 (NP_000145, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. |
| Epitope: | PCGIMDQFISLMGQKGHALLIDCRSLETSLVPLSDPKLAVLITNSNVRHSLASSEYPVRRRQCEEVARALGKESLREVQLEELEAARDLVSKEGFRRAR* ... |
| Specificity: | Mouse polyclonal antibody raised against a partial recombinant GALK1. |
| Purity: | Whole antisera |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. |
| Package Size: | 0.05 ml |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein and cell lysates. Abnova's recommended working dilutions for western analysis are as follows:1:500-1:1000 for polysera |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | GALK1 |
| Omim ID: | 230200, 604313, |