| CatalogCode: | H00002550-M01 |
| ProductName: | GABBR1 Antibody |
| Product Description: | Mouse Monoclonal anti-GABBR1 (2D7) |
| Clone: | 2D7 |
| Clonality: | Monoclonal |
| Immunogen: | GABBR1 (AAH50532, 52 a.a. ~ 151 a.a) partial recombinant protein with GST tag. |
| Epitope: | AVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYG ... |
| Specificity: | GABBR1 - gamma-aminobutyric acid (GABA) B receptor, 1 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Background: | Gamma-aminobutyric acid (GABA) is the main inhibitory neurotransmitter in the mammalian central nervous system. GABA exerts its effects through ionotropic [GABA(A/C)] receptors, to produce fast synaptic inhibition, and metabotropic [GABA(B)] receptors, to produce slow, prolonged inhibitory signals. The GABA(B) receptor consists of a heterodimer of two related 7-transmembrane receptors, GABA(B) receptor 1 and GABA(B) receptor 2. The GABA(B) receptor 1 gene is mapped to chromosome 6p21.3 within the HLA class I region close to the HLA-F gene. Susceptibility loci for multiple sclerosis, epilepsy, and schizophrenia have also been mapped in this region. Alternative splicing of this gene generates 4 transcript variants. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-GABAB(1e) antibody, anti-GABABR1 antibody, anti-GABBR1-3 antibody, anti-GPRC3A antibody, anti-dJ271M21.1.1 antibody, anti-dJ271M21.1.2 antibody, anti-hGB1a antibody |
| ProteinTarget: | GABBR1 - gamma-aminobutyric acid (GABA) B receptor, 1 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 2550 |
| Gene_Symbol: | GABBR1 |
| Omim_ID: | 603540 H00002551-A01 |