ExactAntigen

G6PD Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00002539-M01A
Product Type:Primary Antibody
Product Name:G6PD Antibody
List Price:295
Clonality:Monoclonal
Gene ID:2539
Host:Mouse
Clone:3H5
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-G6PD - glucose-6-phosphate dehydrogenase (3H5)
Cross Reactivity:Human.
Species Summary:Hu(+)
Background:This gene encodes glucose-6-phosphate dehydrogenase. This protein is a cytosolic enzyme encoded by a housekeeping X-linked gene whose main function is to produce NADPH, a key electron donor in the defense against oxidizing agents and in reductive biosynthetic reactions. G6PD is remarkable for its genetic diversity. Many variants of G6PD, mostly produced from missense mutations, have been described with wide ranging levels of enzyme activity and associated clinical symptoms. G6PD deficiency may cause neonatal jaundice, acute hemolysis, or severe chronic non-spherocytic hemolytic anemia. Two transcript variants encoding different isoforms have been found for this gene.
Alternate Names:anti-G6PD1 antibody
Immunogen:G6PD (AAH00337, 406 a.a. ~ 516 a.a) partial recombinant protein with GST tag.
Epitope:TKKPGMFFNPEESELDLTYGNRYKNVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHQIELEKPKPIPYIYGSRGPTEADELMKRVGFQYEGTYKWVNPHKL* ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Packaging:0.1 mg IgG purified Mouse ascites.
PackageSize:0.1 mg
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, , Western Blot 1:500
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
WebLink:www.novusbio.com/data_sheet/index ...
see all human glucose 6 phosphate dehydrogenase antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about