ExactAntigen

Mouse Monoclonal anti-G6PD (3H5)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00002539-M01
ProductName:G6PD Antibody
Product Description:Mouse Monoclonal anti-G6PD (3H5)
Clone:3H5
Clonality:Monoclonal
Immunogen:G6PD (AAH00337, 406 a.a. ~ 516 a.a) partial recombinant protein with GST tag.
Epitope:TKKPGMFFNPEESELDLTYGNRYKNVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHQIELEKPKPIPYIYGSRGPTEADELMKRVGFQYEGTYKWVNPHKL* ...
Specificity:G6PD - glucose-6-phosphate dehydrogenase
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody reactive against recombinant protein on ELISA.
Background:This gene encodes glucose-6-phosphate dehydrogenase. This protein is a cytosolic enzyme encoded by a housekeeping X-linked gene whose main function is to produce NADPH, a key electron donor in the defense against oxidizing agents and in reductive biosynthetic reactions. G6PD is remarkable for its genetic diversity. Many variants of G6PD, mostly produced from missense mutations, have been described with wide ranging levels of enzyme activity and associated clinical symptoms. G6PD deficiency may cause neonatal jaundice, acute hemolysis, or severe chronic non-spherocytic hemolytic anemia. Two transcript variants encoding different isoforms have been found for this gene.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:Ascites
Isotype:IgG2a Kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA
SpeciesSummary:Hu
ALTnames:anti-G6PD antibody, anti-G6PDH antibody, anti-Glucose-6-Phosphate Dehydragenase antibody
ProteinTarget:G6PD - glucose-6-phosphate dehydrogenase
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:2539
Gene_Symbol:G6PD
Omim_ID:305900 H00002539-M01A
see all human glucose 6 phosphate dehydrogenase antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about