ExactAntigen

G1P3 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00002537-M02
Product Type:Primary Antibody
Product Name:G1P3 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:2537
Host:Mouse
Clone:M2
Isotype:IgG1 Kappa
Product Description:Mouse Monoclonal anti-G1P3 (M2)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = G1P3 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.This gene was first
Alternate Names:anti-6-16 antibody, anti-IFI616 antibody
Immunogen:G1P3 (AAH11601, 1 a.a. ~ 131 a.a) full length recombinant protein with GST tag.
Epitope:MRQKAVSLFLCYLLLFTCSGVEAGKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATHKYLDSEEDEE* ...
Specificity:G1P3 - interferon, alpha-inducible protein (clone IFI-6-16)
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody reactive against recombinant protein on ELISA.
Application Summary:ELISA
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:G1P3
Omim ID:147572
see all human IFI6 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about