| request information: |
|
| Catalog Code: | H00002534-M04 |
| Product Name: | FYN Antibody |
| Product Description: | Mouse Monoclonal anti-FYN (2G2) |
| Clone: | 2G2 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 2534 |
| Gene Symbol: | FYN |
| Omim ID: | 137025 |
| Immunogen: | FYN (AAH32496, 1 a.a. ~ 91 a.a) partial recombinant protein with GST tag. |
| Epitope: | MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSF GVTSIPNYNNFHAAGGQGLTVFGGVNSSSHTGTLRTRGGTGV TLFVAL* |
| Specificity: | FYN - FYN oncogene related to SRC, FGR, YES |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Localization: | Cytoplasmic |
| Background: | This gene is a member of the protein-tyrosine kinase oncogene family. It encodes a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein. Alternatively spliced transcript variants encoding distinct isoforms exist. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG Mix kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-Fyn antibody, anti-C syn protooncogene antibody, anti-FYN oncogene related to SRC FGR YES antibody, anti-MGC45350 antibody, anti-OKT3 induced calcium influx regulator antibody, anti-P59 FYN antibody, anti-Protein tyrosine kinase fyn antibody, anti-Proto oncogene tyrosine protein kinase fyn antibody, anti-Protooncogene Syn antibody, anti-SLK antibody, anti-Src like kinase antibody, anti-Src yes related novel gene antibody, anti-Src/yes related novel gene antibody, anti-SYN antibody, anti-Tyrosine kinase p59fyn T antibody, anti-Tyrosine kinase p59fyn(T) antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |