ExactAntigen

FYN Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00002534-M03
Product Type:Primary Antibody
Product Name:FYN Antibody
List Price:275
Clonality:Monoclonal
Gene ID:2534
Host:Mouse
Clone:1A3
Isotype:IgG Mix kappa
Product Description:Mouse Monoclonal anti-FYN (1A3)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = FYN PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.This gene is a member
Alternate Names:anti-FYN antibody, anti-SLK antibody, anti-SYN antibody, anti-MGC45350 antibody, anti-FYN oncogene related to SRC antibody, anti-FGR antibody, anti-YES antibody, anti-src-like kinase antibody, anti-c-syn protooncogene antibody, anti-tyrosine kinase p59fyn
Immunogen:FYN (AAH32496, 1 a.a. ~ 91 a.a) partial recombinant protein with GST tag.
Epitope:MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSSSHTGTLRTRGGTGVTLFVAL* ...
Specificity:FYN - FYN oncogene related to SRC, FGR, YES
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:FYN
Omim ID:137025
see all human FYN antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about