| CatalogCode: | H00002534-M02 |
| ProductName: | FYN Antibody |
| Product Description: | Mouse Monoclonal anti-FYN (3A8) |
| Clone: | 3A8 |
| Clonality: | Monoclonal |
| Immunogen: | FYN (AAH32496, 1 a.a. ~ 91 a.a) partial recombinant protein with GST tag. |
| Epitope: | MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSSSHTGTLRTRGGTGVTLFVAL* ... |
| Specificity: | FYN - FYN oncogene related to SRC, FGR, YES |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene is a member of the protein-tyrosine kinase oncogene family. It encodes a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein. Alternatively spliced transcript variants encoding distinct isoforms exist. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-FYN antibody, anti-SLK antibody, anti-SYN antibody, anti-MGC45350 antibody, anti-FYN oncogene related to SRC antibody, anti-FGR antibody, anti-YES antibody, anti-src-like kinase antibody, anti-c-syn protooncogene antibody, anti-tyrosine kinase p59fyn(T) antibody, anti-src/yes-related novel gene antibody, anti-OKT3-induced calcium influx regulator antibody, anti-proto-oncogene tyrosine-protein kinase fyn antibody |
| ProteinTarget: | FYN - FYN oncogene related to SRC, FGR, YES |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 2534 |
| Gene_Symbol: | FYN |
| Omim_ID: | 137025 H00002534-B01 |
order or
more information: | company product webpage |
| request information: |
|