ExactAntigen

ADAM2 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00002515-B01
Product Type:Primary Antibody
Product Name:ADAM2 Antibody
List Price:295
Clonality:Polyclonal
Gene ID:2515
Host:Mouse
Product Description:Mouse Polyclonal anti-ADAM2 - ADAM metallopeptidase domain 2 (fertilin beta), MaxPab Antibody
Cross Reactivity:Human.
Species Summary:Hu(+)
Background:This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions.
Alternate Names:anti-CRYN1 antibody, anti-CRYN2 antibody, anti-FTNB antibody, anti-PH-30b antibody, anti-PH30 antibody
Immunogen:ADAM2 (-, 1 a.a. ~ 579 a.a) full-length human protein.
Epitope:MWRVLFLLSGLGGLRMDSNFDSLPVQITVPEKIRSIIKEGIESQASYKIVIEGKPYTVNLMQKNFLPHNFRVYSYSGTGIMKPLDQDFQNFCHYQGYIEGYPKSVVMVSTCTGLRGVLQFENVSYGIEPLESSVGFEHVIYQVKHKKADVSLYNEKDIESRDLSFKLQSVEHPRTISLESLAVILAQLLSLSMGITYDDINKCQCSGAVCIMNPEAIHFSGVKIFSNCSFEDFAHFISKQKSQCLHNQPRLDPFF ...
Preservative:No Preservative
Packaging:0.05 ml of mouse antisera with 50% glycerol.
PackageSize:0.05 ml
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Application Summary:Western Blot 1:500, ELISA
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
WebLink:www.novusbio.com/data_sheet/index ...
see all human fertilin beta antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about