| CatalogCode: | | H00002515-A01 |
| ProductName: | | ADAM2 Antibody |
| Product Description: | | Mouse Polyclonal anti-ADAM2 |
| Clonality: | | Polyclonal |
| Immunogen: | | ADAM2 (NP_001455, 376 a.a. ~ 476 a.a) partial recombinant protein with GST tag. |
| Epitope: | | RLDPFFKQQAVCGNAKLEAGEECDCGTEQDCALIGETCCDIATCRFKAGSNCAEGPCCENCLFMSKERMCRPSFEECDLPEYCNGSSASCPENHYVQTGH* ... |
| Specificity: | | ADAM2 - a disintegrin and metalloproteinase domain 2 (fertilin beta) |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | | This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | Whole antisera |
| Host_Name: | | Mouse |
| ListPrice: | | 225 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-FTNB antibody, anti-PH-30b antibody, anti-PH30 antibody |
| ProteinTarget: | | ADAM2 - a disintegrin and metalloproteinase domain 2 (fertilin beta) |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 2515 |
| Gene_Symbol: | | ADAM2 |
| Omim_ID: | | 601533 H00002515-M01 |
| more information: | | company product webpage |