| CatalogCode: | H00002324-M01 |
| ProductName: | FLT4 Antibody |
| Product Description: | Mouse Monoclonal anti-FLT4 (5B6) |
| Clone: | 5B6 |
| Clonality: | Monoclonal |
| Immunogen: | FLT4 (NP_002011, 34 a.a. ~ 133 a.a) partial recombinant protein with GST tag. |
| Epitope: | ITEESHVIDTGDSLSISCRGQHPLEWAWPGAQEAPATGDKDSEDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYKYIKARIEGTTAASSYVFVR ... |
| Specificity: | FLT4 - fms-related tyrosine kinase 4 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene encodes a tyrosine kinase receptor for vascular endothelial growth factors C and D. The protein is thought to be involved in lymphangiogenesis and maintenance of the lymphatic endothelium. Mutations in this gene cause hereditary lymphedema type IA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-FLT41 antibody, anti-PCL antibody, anti-VEGFR3 antibody |
| ProteinTarget: | FLT4 - fms-related tyrosine kinase 4 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 2324 |
| Gene_Symbol: | FLT4 |
| Omim_ID: | 136352, 153100, 602089, |
order or
more information: | company product webpage |
| request information: |
|