| CatalogCode: | | H00002317-A01 |
| ProductName: | | filamin B, beta Antibody |
| Product Description: | | Mouse Polyclonal anti-filamin B, beta |
| Clonality: | | Polyclonal |
| Immunogen: | | FLNB (NP_001448, 2503 a.a. ~ 2603 a.a) partial recombinant protein with GST tag. |
| Epitope: | | SAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTVP* ... |
| Specificity: | | filamin B, beta (actin binding protein 278) |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera
Other applications have not been tested. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | | Mouse |
| ListPrice: | | 225 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-ABP-278 antibody, anti-AOI antibody, anti-DKFZp686A1668 antibody, anti-FH1 antibody, anti-FLN1L antibody, anti-SCT antibody, anti-TABP antibody, anti-TAP antibody, anti-filamin B antibody |
| ProteinTarget: | | filamin B, beta (actin binding protein 278) |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 2317 |
| Gene_Symbol: | | FLNB |
| Omim_ID: | | 108720, 150250, 272460, 603381, |
| more information: | | company product webpage |