| CatalogCode: | | H00002316-M01 |
| ProductName: | | FLNA Antibody |
| Product Description: | | Mouse Monoclonal anti-FLNA (4E10-1B2) |
| Clone: | | 4E10-1B2 |
| Clonality: | | Monoclonal |
| Immunogen: | | FLNA (AAH14654, 1 a.a. ~ 839 a.a) full length recombinant protein with GST tag. |
| Epitope: | | MPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFE ... |
| Specificity: | | FLNA - filamin A, alpha (actin binding protein 280) |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.1 mg IgG purified Mouse ascites. |
| Uses: | | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemistry on paraffin-embedded sections. |
| Background: | | Actin-binding protein, or filamin, is a 280-kD protein that crosslinks actin filaments into orthogonal networks in cortical cytoplasm and participates in the anchoring of membrane proteins for the actin cytoskeleton. Remodeling of the cytoskeleton is central to the modulation of cell shape and migration. Filamin A, encoded by the FLNA gene, is a widely expressed protein that regulates reorganization of the actin cytoskeleton by interacting with integrins, transmembrane receptor complexes, and second messengers.[supplied by OMIM] |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | IgG purified |
| Isotype: | | IgG1 kappa |
| Host_Name: | | Mouse |
| ListPrice: | | 295 |
| AppSummary: | | ELISA, WB, IHC-P |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-ABP-280 antibody, anti-ABPX antibody, anti-FLN antibody, anti-FLN1 antibody, anti-FMD antibody, anti-MNS antibody, anti-NHBP antibody, anti-OPD antibody, anti-OPD1 antibody, anti-OPD2 antibody, anti-filamin A antibody |
| ProteinTarget: | | FLNA - filamin A, alpha (actin binding protein 280) |
| PackageSize: | | 0.1 mg |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 2316 |
| Gene_Symbol: | | FLNA |
| Omim_ID: | | 300,017,300,049,304,000,000,000,000,000 PAB0473 |
| more information: | | company product webpage |