ExactAntigen

FOXO3A Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00002309-M09
Product Type:Primary Antibody
Product Name:FOXO3A Antibody
List Price:275
Clonality:Monoclonal
Gene ID:2309
Host:Mouse
Clone:2D1
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-FOXO3A (2D1)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours.This gene belongs to the forkhead family of transcriptio
Alternate Names:anti-AF6q21 antibody, anti-FKHR2 antibody, anti-FKHRL1 antibody, anti-FKHRL1P2 antibody, anti-Forkhead (Drosophila) homolog (rhabdomyosarcoma) like 1 antibody, anti-DAF16 antibody
Immunogen:FOXO3A (AAH21224, 361 a.a. ~ 460 a.a) partial recombinant protein with GST tag.
Epitope:PCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKGSGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFS ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:100 ug purified IgG
Package Size:100 ug
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:FOXO3A
Omim ID:602681,
see all human FOXO3 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about