| CatalogCode: | H00002309-M08 |
| ProductName: | FOXO3A Antibody |
| Product Description: | Mouse Monoclonal anti-FOXO3A (4F2) |
| Clone: | 4F2 |
| Clonality: | Monoclonal |
| Immunogen: | FOXO3A (AAH21224, 361 a.a. ~ 460 a.a) partial recombinant protein with GST tag. |
| Epitope: | PCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKGSGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFS ... |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. This antibody has also been used in Immunohistochemistry of paraffin embedded sections. |
| Background: | This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. This gene likely functions as a trigger for apoptosis through expression of genes necessary for cell death. Translocation of this gene with the MLL gene is associated with secondary acute leukemia. Alternatively spliced transcript variants encoding the same protein have been observed. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB, IHC-P |
| SpeciesSummary: | Hu |
| ALTnames: | anti-AF6q21 antibody, anti-FKHR2 antibody, anti-FKHRL1 antibody, anti-FKHRL1P2 antibody, anti-Forkhead (Drosophila) homolog (rhabdomyosarcoma) like 1 antibody, anti-DAF16 antibody |
| ProteinTarget: | forkhead box O3A |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 2309 |
| Gene_Symbol: | FOXO3A |
| Omim_ID: | 602681, |