| Catalog Code: | H00002308-M03 |
| Product Type: | Primary Antibody |
| Product Name: | FOXO1A Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 2308 |
| Host: | Mouse |
| Clone: | 4B4 |
| Product Description: | Mouse Monoclonal anti-FOXO1A (4B4) |
| Species Summary: | Hu |
| Background: | This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. Tr |
| Alternate Names: | anti-FOXO1a antibody, anti-forkhead box O1a antibody, anti-FKH1 antibody, anti-forkhead homolog1 antibody, anti-FKHR antibody, anti-forkhead rhabdomysarcoma antibody |
| Immunogen: | FOXO1A (NP_002006, 556 a.a. ~ 656 a.a) partial recombinant protein with GST tag. |
| Epitope: | TQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG* ... |
| Purity: | protein A purified |
| Buffer: | 1x PBS, pH 7.2 |
| Packaging: | 0.1 ml protein A purified Mouse ascites. |
| Package Size: | 0.1 ml |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | FOXO1A |
| Omim ID: | 136533, 268220, |
|