ExactAntigen

Mouse Monoclonal anti-forkhead box O1A (4E9)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00002308-M01
ProductName:forkhead box O1A Antibody
Product Description:Mouse Monoclonal anti-forkhead box O1A (4E9)
Clone:4E9
Clonality:Monoclonal
Immunogen:FOXO1A (NP_002006, 556 a.a. ~ 656 a.a) partial recombinant protein with GST tag.
Epitope:TQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG* ...
Specificity:forkhead box O1A (rhabdomyosarcoma)
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background:This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of this gene with PAX3 has been associated with alveolar rhabdomyosarcoma.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host_Name:Mouse
Buffer:1X PBS pH 7.2
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-FKH1 antibody, anti-FKHR antibody, anti-FOXO1 antibody
ProteinTarget:forkhead box O1A (rhabdomyosarcoma)
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:2308
Gene_Symbol:FOXO1A
Omim_ID:136533, 268220,
see all human FOXO1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about