| CatalogCode: | H00002308-M01 |
| ProductName: | forkhead box O1A Antibody |
| Product Description: | Mouse Monoclonal anti-forkhead box O1A (4E9) |
| Clone: | 4E9 |
| Clonality: | Monoclonal |
| Immunogen: | FOXO1A (NP_002006, 556 a.a. ~ 656 a.a) partial recombinant protein with GST tag. |
| Epitope: | TQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG* ... |
| Specificity: | forkhead box O1A (rhabdomyosarcoma) |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of this gene with PAX3 has been associated with alveolar rhabdomyosarcoma. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| Buffer: | 1X PBS pH 7.2 |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-FKH1 antibody, anti-FKHR antibody, anti-FOXO1 antibody |
| ProteinTarget: | forkhead box O1A (rhabdomyosarcoma) |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 2308 |
| Gene_Symbol: | FOXO1A |
| Omim_ID: | 136533, 268220, |