| CatalogCode: | | H00002308-A01 |
| ProductName: | | FOXO1A Antibody |
| Product Description: | | Mouse Polyclonal anti-FOXO1A |
| Clonality: | | Polyclonal |
| Immunogen: | | FOXO1A (NP_002006, 556 a.a. ~ 656 a.a) partial recombinant protein with GST tag. |
| Epitope: | | TQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG* ... |
| Specificity: | | FOXO1A - forkhead box O1A (rhabdomyosarcoma) |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500-1:1000 for polysera |
| Background: | | This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of this gene with PAX3 has been associated with alveolar rhabdomyosarcoma. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | Whole antisera |
| Host_Name: | | Mouse |
| ListPrice: | | 225 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-FOXO1a antibody, anti-forkhead box O1a antibody, anti-FKH1 antibody, anti-forkhead homolog1 antibody, anti-FKHR antibody, anti-forkhead rhabdomysarcoma antibody |
| ProteinTarget: | | FOXO1A - forkhead box O1A (rhabdomyosarcoma) |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 2308 |
| Gene_Symbol: | | FOXO1A |
| Omim_ID: | | 136533 268220 |
| more information: | | company product webpage |