| Catalog Code: | H00002305-M05 |
| Product Type: | Primary Antibody |
| Product Name: | FOXM1 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 2305 |
| Host: | Mouse |
| Clone: | 2H4 |
| Isotype: | IgG2a Kappa |
| Product Description: | Mouse Monoclonal anti-FOXM1 (2H4) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours. |
| Alternate Names: | anti-FKHL16 antibody, anti-FOXM1B antibody, anti-HFH-11 antibody, anti-HFH11 antibody, anti-HNF-3 antibody, anti-INS-1 antibody, anti-MPHOSPH2 antibody, anti-MPP-2 antibody, anti-MPP2 antibody, anti-PIG29 antibody, anti-TRIDENT antibody |
| Immunogen: | FOXM1 (NP_973731, 22 a.a. ~ 110 a.a) full length recombinant protein with GST tag. |
| Epitope: | NAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPAGIKIINHPTMPNTQVVAIPNNANIHSIITALTAKGKESGSSGPNKFILIS* ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Package Size: | 0.1 mg |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | FOXM1 |
| Omim ID: | 602341, |
|