| CatalogCode: | | H00002305-M01 |
| ProductName: | | FOXM1 Antibody |
| Product Description: | | Mouse Monoclonal anti-FOXM1 (3A9) |
| Clone: | | 3A9 |
| Clonality: | | Monoclonal |
| Immunogen: | | FOXM1 (NP_973731, 702 a.a. ~ 802 a.a) partial recombinant protein with GST tag. |
| Epitope: | | LQSAPPLESPQRLLSSEPLDLISVPFGNSSPSDIDVPKPGSPEPQVSGLAANRSLTEGLVLDTMNDSLSKILLDISFPGLDEDPLGPDNINWSQFIPELQ* ... |
| Specificity: | | FOXM1 - forkhead box M1 |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.1 mg IgG purified Mouse ascites. |
| Uses: | | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | IgG purified |
| Isotype: | | IgG2a Kappa |
| Host_Name: | | Mouse |
| ListPrice: | | 295 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-FKHL16 antibody, anti-Forkhead box M1 antibody, anti-Forkhead drosophila homolog like 16 antibody, anti-Forkhead Drosophila like 16 antibody, anti-FOXM1 antibody, anti-HFH11 antibody, anti-HNF3 antibody, anti-INS1 antibody, anti-MPHOSPH2 antibody, anti-MPP2 antibody, anti-Trident antibody |
| ProteinTarget: | | FOXM1 - forkhead box M1 |
| PackageSize: | | 0.1 mg |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 2305 |
| Gene_Symbol: | | FOXM1 |
| Omim_ID: | | 602341 H00002305-M02 |
| more information: | | company product webpage |