ExactAntigen

Mouse Monoclonal anti-FOXM1 (3A9) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00002305-M01
ProductName: FOXM1 Antibody
Product Description: Mouse Monoclonal anti-FOXM1 (3A9)
Clone: 3A9
Clonality: Monoclonal
Immunogen: FOXM1 (NP_973731, 702 a.a. ~ 802 a.a) partial recombinant protein with GST tag.
Epitope: LQSAPPLESPQRLLSSEPLDLISVPFGNSSPSDIDVPKPGSPEPQVSGLAANRSLTEGLVLDTMNDSLSKILLDISFPGLDEDPLGPDNINWSQFIPELQ* ...
Specificity: FOXM1 - forkhead box M1
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG2a Kappa
Host_Name: Mouse
ListPrice: 295
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-FKHL16 antibody, anti-Forkhead box M1 antibody, anti-Forkhead drosophila homolog like 16 antibody, anti-Forkhead Drosophila like 16 antibody, anti-FOXM1 antibody, anti-HFH11 antibody, anti-HNF3 antibody, anti-INS1 antibody, anti-MPHOSPH2 antibody, anti-MPP2 antibody, anti-Trident antibody
ProteinTarget: FOXM1 - forkhead box M1
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 2305
Gene_Symbol: FOXM1
Omim_ID: 602341 H00002305-M02
more information: company product webpage
Also see:
see all human FOXM1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about