ExactAntigen

FGFR2 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00002263-M04
Product Type:Primary Antibody
Product Name:FGFR2 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:2263
Host:Mouse
Clone:3F4
Isotype:IgG2b Kappa
Product Description:Mouse Monoclonal anti-FGFR2 (3F4)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = FGFR2 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.The protein encoded
Alternate Names:anti-BEK antibody, anti-BFR-1 antibody, anti-CEK3 antibody, anti-CFD1 antibody, anti-ECT1 antibody, anti-JWS antibody, anti-K-SAM antibody, anti-KGFR antibody, anti-TK14 antibody, anti-TK25 antibody
Immunogen:FGFR2 (AAH39243, 621 a.a. ~ 724 a.a) partial recombinant protein with GST tag.
Epitope:GHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT* ...
Specificity:FGFR2 - fibroblast growth factor receptor 2 (bacteria-expressed kinase, keratinocyte growth factor receptor, craniofacial dysostosis 1, Crouzon syndrome, Pfeiffer syndrome, Jackson-Weiss syndrome)
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody reactive against recombinant protein on ELISA.
Application Summary:ELISA
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:FGFR2
Omim ID:101200101400101000000000000000000000000000000000 ...
see all human FGFR2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about