| Catalog Code: | H00002263-M03 |
| Product Type: | Primary Antibody |
| Product Name: | FGFR2 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 2263 |
| Host: | Mouse |
| Clone: | 2C11 |
| Isotype: | IgG2b Kappa |
| Product Description: | Mouse Monoclonal anti-FGFR2 (2C11) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | NCBI Entrez Gene ID = FGFR2 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.The protein encoded |
| Alternate Names: | anti-BEK antibody, anti-BFR-1 antibody, anti-CEK3 antibody, anti-CFD1 antibody, anti-ECT1 antibody, anti-JWS antibody, anti-K-SAM antibody, anti-KGFR antibody, anti-TK14 antibody, anti-TK25 antibody |
| Immunogen: | FGFR2 (AAH39243, 621 a.a. ~ 724 a.a) partial recombinant protein with GST tag. |
| Epitope: | GHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT* ... |
| Specificity: | FGFR2 - fibroblast growth factor receptor 2 (bacteria-expressed kinase, keratinocyte growth factor receptor, craniofacial dysostosis 1, Crouzon syndrome, Pfeiffer syndrome, Jackson-Weiss syndrome) |
| Purity: | IgG purified |
| Packaging: | 100 ug purified IgG |
| Package Size: | 0.1 ml |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | FGFR2 |
| Omim ID: | 101200, 101400, 101600, 123150, 123500, 123790, 137215, 176943 |
|