ExactAntigen

FGFR1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00002260-M13
Product Type:Primary Antibody
Product Name:FGFR1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:2260
Host:Mouse
Clone:3B2
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-FGFR1 (3B2)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:The protein encoded by this gene is a member of the fibroblast growth factor receptor (FGFR) family, where amino acid sequence is highly conserved between members and throughout evolution. FGFR family members differ from one another in their ligand affini
Alternate Names:anti-BFGFR antibody, anti-C-FGR antibody, anti-CEK antibody, anti-FLG antibody, anti-FLT2 antibody, anti-H2 antibody, anti-H3 antibody, anti-H4 antibody, anti-H5 antibody, anti-KAL2 antibody, anti-N-SAM antibody
Immunogen:FGFR1 (NP_000595, 303 a.a. ~ 408 a.a) full length recombinant protein with GST tag.
Epitope:DNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIVYKMKSGTKKSDF* ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:0.1 mg IgG purified Mouse ascites.
Package Size:0.1 mg
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:FGFR1
Omim ID:101600, 123150, 136350, 147950,
see all human FGFR1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about