| Catalog Code: | H00002260-M09 |
| Product Type: | Primary Antibody |
| Product Name: | FGFR1 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 2260 |
| Host: | Mouse |
| Clone: | 1B12 |
| Isotype: | IgG2b Kappa |
| Product Description: | Mouse Monoclonal anti-FGFR1 (1B12) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | The protein encoded by this gene is a member of the fibroblast growth factor receptor (FGFR) family, where amino acid sequence is highly conserved between members and throughout evolution. FGFR family members differ from one another in their ligand affini |
| Alternate Names: | anti-BFGFR antibody, anti-C-FGR antibody, anti-CEK antibody, anti-FLG antibody, anti-FLT2 antibody, anti-H2 antibody, anti-H3 antibody, anti-H4 antibody, anti-H5 antibody, anti-KAL2 antibody, anti-N-SAM antibody |
| Immunogen: | FGFR1 (NP_000595, 303 a.a. ~ 408 a.a) full length recombinant protein with GST tag. |
| Epitope: | DNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIVYKMKSGTKKSDF* ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Package Size: | 0.1 mg |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | FGFR1 |
| Omim ID: | 101600, 123150, 136350, 147950, |
|