ExactAntigen

FGFR1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00002260-M03
Product Type:Primary Antibody
Product Name:FGFR1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:2260
Host:Mouse
Clone:2E9
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-FGFR1 (2E9)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = FGFR1 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.The protein encoded
Alternate Names:anti-Basic fibroblast growth factor receptor 1 antibody, anti-bFGF R antibody, anti-BFGFR antibody, anti-C FGR antibody, anti-CEK antibody, anti-FGFBR antibody, anti-FGFR 1 antibody, anti-FLG protein antibody, anti-FLJ14326 antibody, anti-FLT 2 antibody,
Immunogen:FGFR1 (AAH15035, 31 a.a. ~ 150 a.a) partial recombinant protein with GST tag.
Epitope:AQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSDALPSSEDDDDDDDSSSEEKETDNTKPNRMP ...
Specificity:FGFR1 - fibroblast growth factor receptor 1 (fms-related tyrosine kinase 2, Pfeiffer syndrome)
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:FGFR1
Omim ID:101600, 123150, 136350, 147950,
see all human FGFR1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about