ExactAntigen

Mouse Monoclonal anti-FES (3A3-1E5)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00002242-M01
ProductName:FES Antibody
Product Description:Mouse Monoclonal anti-FES (3A3-1E5)
Clone:3A3-1E5
Clonality:Monoclonal
Immunogen:FES (AAH35357, 1 a.a. ~ 823 a.a) full length recombinant protein with GST tag.
Epitope:MGFSSELCSPQGHGVLQQMQEAELRLLEGMRKWMAQRVKSDREYAGLLHHMSLQDSGGQSRAISPDSPISQSWAEITSQTEGLSRLLRQHAEDLNSGPLSKLSLLIRERQQLRKTYSEQWQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAAAAARI ...
Specificity:FES - feline sarcoma oncogene
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG1 kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-FPS antibody
ProteinTarget:FES - feline sarcoma oncogene
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:2242
Gene_Symbol:FES
Omim_ID:190030 NB600-1090
see all human FES antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about