| CatalogCode: | H00002194-M01 |
| ProductName: | FASN Antibody |
| Product Description: | Mouse Monoclonal anti-FASN (3F2-1F3) |
| Clone: | 3F2-1F3 |
| Clonality: | Monoclonal |
| Immunogen: | FASN (AAH07909, 1 a.a. ~ 440 a.a) full length recombinant protein with GST tag. |
| Epitope: | MSTNDTIVSGTLPQRMASCLEVLDLFLNQPHMVLSSFVLAEKAAAYRDRDSQRDLVEAVAHILGIRDLAAVNLDSSLADLGLDSLMSVEVRQTLERELNLVLSVREVRQLTLRKLQELSSKADEASELACPTPKEDGLAQQQTQLNLRSLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSP ... |
| Specificity: | FASN - fatty acid synthase |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemistry on paraffin-embedded sections. |
| Background: | The enzyme encoded by this gene is a multifunctional protein. Its main function is to catalyze the synthesis of palmitate from acetyl-CoA and malonyl-CoA, in the presence of NADPH, into long-chain saturated fatty acids. In some cancer cell lines, this protein has been found to be fused with estrogen receptor-alpha (ER-alpha), in which the N-terminus of FAS is fused in-frame with the C-terminus of ER-alpha. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB, IHC-P |
| SpeciesSummary: | Hu |
| ALTnames: | anti-FAS antibody, anti-MGC14367 antibody, anti-MGC15706 antibody, anti-OA-519 antibody |
| ProteinTarget: | FASN - fatty acid synthase |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 2194 |
| Gene_Symbol: | FASN |
| Omim_ID: | 600212 H00002194-B01 |
order or
more information: | company product webpage |
| request information: |
|